Loading...
Statistics
Advertisement

Freizeitcenter Freestyle
www.sportladen24.com/

Sportladen24.com

Advertisement
Sportladen24.com is hosted in Germany . Sportladen24.com uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Sportladen24.com

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Sportladen24.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.speicherzentrum.de
    • subject:
      • OU: Domain Control Validated
      • CN: *.speicherzentrum.de
    • hash: 2739869f
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: AlphaSSL CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492162569962076753442655442665795278676452
    • validFrom: 151130102721Z
    • validTo: 170125113732Z
    • validFrom_time_t: 1448879241
    • validTo_time_t: 1485344252
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.speicherzentrum.de, DNS:speicherzentrum.de
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl2.alphassl.com/gs/gsalphasha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure2.alphassl.com/cacert/gsalphasha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsalphasha2g2
      • subjectKeyIdentifier: 55:40:98:47:31:79:DB:64:6B:35:05:F9:91:EB:78:4A:E1:88:7C:27
      • authorityKeyIdentifier: keyid:F5:CD:D5:3C:08:50:F9:6A:4F:3A:B7:97:DA:56:83:E6:69:D2:68:F7

Meta - Sportladen24.com

Number of occurences: 5
  • Name:
    Content: 0
  • Name: author
    Content:
  • Name: description
    Content:
  • Name: keywords
    Content:
  • Name: generator
    Content: Web2Date BASIC

Server / Hosting

  • IP: 178.254.62.91
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • ns5.speicherzentrum.de
  • ns4.speicherzentrum.de
  • ns6.speicherzentrum.de
  • mail.sportladen24.com

Target

  • dnsmaster.speicherzentrum.de

HTTP Header Response

HTTP/1.1 200 OK Date: Fri, 26 Aug 2016 20:59:34 GMT Server: Apache Last-Modified: Thu, 27 Aug 2009 05:41:32 GMT ETag: "366d525-748-4721905173b00" Accept-Ranges: bytes Content-Length: 1864 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

DNS

host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 178.254.62.91
host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns5.speicherzentrum.de
host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4.speicherzentrum.de
host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns6.speicherzentrum.de
host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns4.speicherzentrum.de
  5. rname: dnsmaster.speicherzentrum.de
  6. serial: 2016031201
  7. refresh: 14400
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 86400
host: sportladen24.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mail.sportladen24.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.portladen24.com, www.seportladen24.com, www.eportladen24.com, www.swportladen24.com, www.wportladen24.com, www.sdportladen24.com, www.dportladen24.com, www.sxportladen24.com, www.xportladen24.com, www.sfportladen24.com, www.fportladen24.com, www.sgportladen24.com, www.gportladen24.com, www.stportladen24.com, www.tportladen24.com, www.sortladen24.com, www.spiortladen24.com, www.siortladen24.com, www.spkortladen24.com, www.skortladen24.com, www.spuortladen24.com, www.suortladen24.com, www.spjortladen24.com, www.sjortladen24.com, www.splortladen24.com, www.slortladen24.com, www.sprtladen24.com, www.spobrtladen24.com, www.spbrtladen24.com, www.spohrtladen24.com, www.sphrtladen24.com, www.spogrtladen24.com, www.spgrtladen24.com, www.spojrtladen24.com, www.spjrtladen24.com, www.spomrtladen24.com, www.spmrtladen24.com, www.spo rtladen24.com, www.sp rtladen24.com, www.spovrtladen24.com, www.spvrtladen24.com, www.spotladen24.com, www.sporitladen24.com, www.spoitladen24.com, www.sporotladen24.com, www.spootladen24.com, www.sporltladen24.com, www.spoltladen24.com, www.sporltladen24.com, www.spoltladen24.com, www.spor.tladen24.com, www.spo.tladen24.com, www.sporladen24.com, www.sportqladen24.com, www.sporqladen24.com, www.sportaladen24.com, www.sporaladen24.com, www.sport laden24.com, www.spor laden24.com, www.sportwladen24.com, www.sporwladen24.com, www.sporteladen24.com, www.sporeladen24.com, www.sportzladen24.com, www.sporzladen24.com, www.sportxladen24.com, www.sporxladen24.com, www.sportcladen24.com, www.sporcladen24.com, www.sportaden24.com, www.sportluaden24.com, www.sportuaden24.com, www.sportl8aden24.com, www.sport8aden24.com, www.sportl9aden24.com, www.sport9aden24.com, www.sportljaden24.com, www.sportjaden24.com, www.sportl0aden24.com, www.sport0aden24.com, www.sportlmaden24.com, www.sportmaden24.com, www.sportlpaden24.com, www.sportpaden24.com, www.sportloaden24.com, www.sportoaden24.com, www.sportlden24.com, www.sportlaoden24.com, www.sportloden24.com, www.sportlapden24.com, www.sportlpden24.com, www.sportla9den24.com, www.sportl9den24.com, www.sportladen24.com, www.sportlden24.com, www.sportlaiden24.com, www.sportliden24.com, www.sportlauden24.com, www.sportluden24.com, www.sportlaen24.com, www.sportladten24.com, www.sportlaten24.com, www.sportladgen24.com, www.sportlagen24.com, www.sportladben24.com, www.sportlaben24.com, www.sportladxen24.com, www.sportlaxen24.com, www.sportladsen24.com, www.sportlasen24.com, www.sportladfen24.com, www.sportlafen24.com, www.sportladven24.com, www.sportlaven24.com, www.sportladyen24.com, www.sportlayen24.com, www.sportladzen24.com, www.sportlazen24.com, www.sportladaen24.com, www.sportlaaen24.com, www.sportladeen24.com, www.sportlaeen24.com, www.sportladren24.com, www.sportlaren24.com, www.sportladn24.com, www.sportladexn24.com, www.sportladxn24.com, www.sportladesn24.com, www.sportladsn24.com, www.sportladewn24.com, www.sportladwn24.com, www.sportladern24.com, www.sportladrn24.com, www.sportladefn24.com, www.sportladfn24.com, www.sportladevn24.com, www.sportladvn24.com, www.sportladecn24.com, www.sportladcn24.com, www.sportladeqn24.com, www.sportladqn24.com, www.sportladean24.com, www.sportladan24.com, www.sportladeyn24.com, www.sportladyn24.com, www.sportlade24.com, www.sportladenn24.com, www.sportladen24.com, www.sportladenh24.com, www.sportladeh24.com, www.sportladenj24.com, www.sportladej24.com, www.sportladenk24.com, www.sportladek24.com, www.sportladenl24.com, www.sportladel24.com, www.sportladen 24.com, www.sportlade 24.com, www.sportladen4.com, www.sportladen204.com, www.sportladen04.com, www.sportladen2q4.com, www.sportladenq4.com, www.sportladen2w4.com, www.sportladenw4.com,

Other websites we recently analyzed

  1. wmed24.com
    Germany - 212.227.247.28
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  2. coachlinkllc.com
    Road Town (Virgin Islands, British) - 208.91.197.46
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Newton County, GA - Pay Traffic Tickets
    Ashburn (United States) - 52.22.197.228
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery Validate, Modernizr.js
    Number of Javascript: 13
    Number of meta tags: 7
  4. dalimandala.com
    Scottsdale (United States) - 50.63.202.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. chefs2you.com
    United States - 192.195.77.236
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  6. Overseesjob
    United Kingdom - 95.215.224.23
    Server software: Microsoft-IIS/7.5
    Technology: BootstrapCDN, CSS, Font Awesome, Html, Javascript, jQuery, SVG
    Number of Javascript: 169
    Number of meta tags: 1
  7. federalcriminalappealslawyers.com
    Scottsdale (United States) - 50.63.202.60
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  8. sanvini.nl
    sanvini.nl
    Netherlands - 62.148.163.233
    Server software: Apache
    Technology: CSS, Html, Html5
    Number of Javascript: 1
    Number of meta tags: 6
  9. Spółdzielnia Mieszkaniowa w Jarosławiu
    Jaroslaw (Poland) - 185.25.120.34
    Server software:
    Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Lightbox, Php, Pingback, Wordpress
    Number of Javascript: 44
    Number of meta tags: 4
  10. eternal-promi.se.net
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1

Check Other Websites